Cryptogram from Pride and Prejudice, chapter 37
The second of three cryptograms from chapter 37 of Pride and Prejudice. Every letter below stands for a different one, the same way all the way through, and no letter ever stands for itself.
Jlncwblfycqvlniskibkjquymglmygijwnkgsyskcskppycsys,kttlgsrcwplpvyrgqrpnkprlcrcirhy.
- Written byJane Austen
- Taken fromPride and Prejudice
- Difficultymedium
- Length81 letters, 20 unique
Where it comes from
Jane Austen wrote it in chapter 37 of Pride and Prejudice. Here is the prose either side of it, with the sentence you are solving left out.
The sentence you are solving goes here.
"My uncle is to send a servant for us."
One paragraph next to it is a cryptogram here in its own right, so it is left out too: the medium one from chapter 37.
Text from the Project Gutenberg edition, which is in the public domain in the United States.
Want the answer?
Have a proper go at it first. The solution is on a page of its own, so you won’t run into it by accident.
Nearby in the book
The puzzles either side of this one in the novel.
- Chapter 36easy, 80 letters
- Chapter 37medium, 61 letters
- Chapter 37hard, 73 letters
- Chapter 38easy, 98 letters
About as hard as this one
Scored closest to it by the model behind our guide to solving cryptograms.
- Chapter 46medium, 61 letters
- Chapter 7medium, 59 letters
- Chapter 18medium, 77 letters
- Chapter 39medium, 58 letters
Every Pride and Prejudice cryptogram · About the collection · More by Jane Austen