Cryptogram from Pride and Prejudice, chapter 46
The fourth of ten cryptograms from chapter 46 of Pride and Prejudice. Every letter below stands for a different one, the same way all the way through, and no letter ever stands for itself.
Ybhgpcplqhgyleaqkwqkvrhtiphqeyfpaqkjcpbplhcpvyps?Tevtbbqsnylp;bgtvvYephaqkqlp?
- Written byJane Austen
- Taken fromPride and Prejudice
- Difficultymedium
- Length75 letters, 20 of them different
Where it comes from
Jane Austen wrote it in chapter 46 of Pride and Prejudice. Here is the prose either side of it, with the sentence you are solving left out.
Elizabeth hesitated; but her knees trembled under her, and she felt how little would be gained by her attempting to pursue them. Calling back the servant, therefore, she commissioned him, though in so breathless an accent as made her almost unintelligible, to fetch his master and mistress home instantly.
The sentence you are solving goes here.
"No, I thank you," she replied, endeavouring to recover herself. "There is nothing the matter with me. I am quite well, I am only distressed by some dreadful news which I have just received from Longbourn."
Text from the Project Gutenberg edition, which is in the public domain in the United States.
Want the answer?
Have a proper go at it first. The solution is on a page of its own, so you won’t run into it by accident.
Nearby in the book
The puzzles either side of this one in the novel.
- Chapter 46medium, 98 letters
- Chapter 46hard, 57 letters
- Chapter 46easy, 83 letters
- Chapter 46medium, 53 letters
About as hard as this one
Scored closest to it by the model behind our guide to solving cryptograms.
- Chapter 31medium, 96 letters
- Chapter 4medium, 87 letters
- Chapter 54medium, 60 letters
- Chapter 51medium, 86 letters
Every Pride and Prejudice cryptogram · About the collection · More by Jane Austen