Cryptogram from Frankenstein; or, the modern prometheus, chapter 21
The third of ten cryptograms from chapter 21 of Frankenstein; or, the modern prometheus. Every letter below stands for a different one, the same way all the way through, and no letter ever stands for itself.
VxyxtgkpqdkgymstnipsnspaydetwwsdvvxykasplyevxkvLypitdyi,kpiLbkemkddlyistvsqvxydssglpevdspamsprtnelspe.
- Written byMary Wollstonecraft Shelley
- Taken fromFrankenstein; or, the modern prometheus
- Difficultyeasy
- Length100 letters, 19 unique
Where it comes from
Mary Wollstonecraft Shelley wrote it in chapter 21 of Frankenstein; or, the modern prometheus. Here is the prose either side of it, with the sentence you are solving left out.
The sentence you are solving goes here.
A fever succeeded to this. I lay for two months on the point of death; my ravings, as I afterwards heard, were frightful; I called myself the murderer of William, of Justine, and of Clerval. Sometimes I entreated my attendants to assist me in the destruction of the fiend by whom I was tormented; and at others I felt the fingers of the monster already grasping my neck, and screamed aloud with agony and terror. Fortunately, as I spoke my native language, Mr. Kirwin alone understood me; but my gestures and bitter cries were sufficient to affright the other witnesses.
One paragraph next to it is a cryptogram here in its own right, so it is left out too: the medium one from chapter 21.
Text from the Project Gutenberg edition, which is in the public domain in the United States.
Want the answer?
Have a proper go at it first. The solution is on a page of its own, so you won’t run into it by accident.
Nearby in the book
The puzzles either side of this one in the novel.
- Chapter 21medium, 89 letters
- Chapter 21medium, 84 letters
- Chapter 21hard, 71 letters
- Chapter 21easy, 71 letters
About as hard as this one
Scored closest to it by the model behind our guide to solving cryptograms.
- Chapter 8easy, 89 letters
- Chapter 21easy, 95 letters
- Chapter 7easy, 96 letters
- Chapter 24easy, 93 letters
Every Frankenstein; or, the modern prometheus cryptogram · About the collection · More by Mary Wollstonecraft Shelley