Cryptogram from Frankenstein; or, the modern prometheus, chapter 21

The third of ten cryptograms from chapter 21 of Frankenstein; or, the modern prometheus. Every letter below stands for a different one, the same way all the way through, and no letter ever stands for itself.

VxyxtgkpqdkgymstnipsnspaydetwwsdvvxykasplyevxkvLypitdyi,kpiLbkemkddlyistvsqvxydssglpevdspamsprtnelspe.

Where it comes from

Mary Wollstonecraft Shelley wrote it in chapter 21 of Frankenstein; or, the modern prometheus. Here is the prose either side of it, with the sentence you are solving left out.

The sentence you are solving goes here.

A fever succeeded to this. I lay for two months on the point of death; my ravings, as I afterwards heard, were frightful; I called myself the murderer of William, of Justine, and of Clerval. Sometimes I entreated my attendants to assist me in the destruction of the fiend by whom I was tormented; and at others I felt the fingers of the monster already grasping my neck, and screamed aloud with agony and terror. Fortunately, as I spoke my native language, Mr. Kirwin alone understood me; but my gestures and bitter cries were sufficient to affright the other witnesses.

One paragraph next to it is a cryptogram here in its own right, so it is left out too: the medium one from chapter 21.

Text from the Project Gutenberg edition, which is in the public domain in the United States.

Want the answer?

Have a proper go at it first. The solution is on a page of its own, so you won’t run into it by accident.

Show the solved quotation

Nearby in the book

The puzzles either side of this one in the novel.

About as hard as this one

Scored closest to it by the model behind our guide to solving cryptograms.

Every Frankenstein; or, the modern prometheus cryptogram · About the collection · More by Mary Wollstonecraft Shelley